Overview and Effects of Beinaglutide

Beinaglutide is a human GLP-1 polypeptide with CAS number 123475-27-4 and almost 100% homology to human GLP-1 (7-36). Benaglutide has shown dose-dependent effects in glycemic control, inhibition of food intake and gastric emptying, and promotion of weight loss. Benaglutide has the potential to study overweight/obesity and nonalcoholic steatohepatitis (NASH).

Basic information
Chinese name: Benaglutide
English name: Beinaglutide
Company number: GT-M19402
CAS Number: 123475-27-4
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Formula: C149H225N39O46
Molecular weight: 3298.61

This high degree of structural similarity allows benaglutide to mimic GLP-1 in the human body, thereby acting in multiple physiological processes. First, benaglutide has shown significant results in blood sugar control. It helps regulate blood sugar levels and keeps them within a relatively stable range, which is especially important for diabetics.
In addition, benaglutide also has a significant inhibitory effect on food intake and gastric emptying. This means that when the body ingests benaglutide, it can slow down the emptying of the stomach, which can make people feel fuller, help reduce food intake, and help with weight management. In addition, benaglutide is also able to promote weight loss, which has been confirmed in several studies.

It is important to note that the effects of benaglutide are dose-dependent, i.e., its effects are enhanced with increasing doses. This allows doctors to adjust the dosage of benaglutide according to the patient's specific situation to achieve the best treatment effect.

Anyone need polypeptide api, plz contact haoran.tse@gmail.com Tel: +8618575536586