Beinaglutide is a human GLP-1 polypeptide with CAS number 123475-27-4 and almost 100% homology to human GLP-1 (7-36). Benaglutide has shown dose-dependent effects in glycemic control, inhibition of food intake and gastric emptying, and promotion of weight loss. Benaglutide has the potential to study overweight/obesity and nonalcoholic steatohepatitis (NASH).

Basic information
Chinese name: Benaglutide
English name: Beinaglutide
Company number: GT-M19402
CAS Number: 123475-27-4
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Formula: C149H225N39O46
Molecular weight: 3298.61

This high degree of structural similarity allows benaglutide to mimic GLP-1 in the human body, thereby acting in multiple physiological processes. First, benaglutide has shown significant results in blood sugar control. It helps regulate blood sugar levels and keeps them within a relatively stable range, which is especially important for diabetics.
In addition, benaglutide also has a significant inhibitory effect on food intake and gastric emptying. This means that when the body ingests benaglutide, it can slow down the emptying of the stomach, which can make people feel fuller, help reduce food intake, and help with weight management. In addition, benaglutide is also able to promote weight loss, which has been confirmed in several studies.

It is important to note that the effects of benaglutide are dose-dependent, i.e., its effects are enhanced with increasing doses. This allows doctors to adjust the dosage of benaglutide according to the patient's specific situation to achieve the best treatment effect.

Anyone need polypeptide api, plz contact haoran.tse@gmail.com Tel: +8618575536586

About the semaglutide api price, i would like to share some info.
A post by Girish S Sonar
Read the post
As we inch closer to the generic entry window of 𝗢𝗿𝗮𝗹 𝗦𝗲𝗺𝗮𝗴𝗹𝘂𝘁𝗶𝗱𝗲, the economics remain a tough nut to crack for many generic players.
According to QYOBO https://lnkd.in/dydt9kJG, Semaglutide API prices have declined 𝟲𝟬–𝟳𝟲% since 2020, reaching a corridor of $𝟯𝟯𝟬–𝟰𝟯𝟬/𝗴 by early 2025. But even at $𝟯𝟴𝟬/𝗴, 𝗮 𝟭𝟰 𝗺𝗴 𝘁𝗮𝗯𝗹𝗲𝘁 would still require an API worth $5.32/tablet — far beyond the range of commercial feasibility in GCC.
Let’s analyze the viability using 𝗚𝗖𝗖 𝗺𝗮𝗿𝗸𝗲𝘁 𝗱𝗮𝘁𝗮 (source: Pi Pharma Intelligence https://lnkd.in/d5pqHTZD):

𝗣𝘂𝗯𝗹𝗶𝗰 𝗽𝗿𝗶𝗰𝗲𝘀 𝗳𝗼𝗿 𝗥𝘆𝗯𝗲𝗹𝘀𝘂𝘀 𝟭𝟰 𝗺𝗴 (𝟯𝟬’𝘀 𝗽𝗮𝗰𝗸):
· KSA: $4.06/tab
· UAE: $5.82/tab
· Qatar: $6.52/tab
· Kuwait: $4.61/tab
· Bahrain: $4.19/tab
· Oman: $4.87/tab
· Jordan: $4.96/tab

𝗔𝘀 𝗽𝗲𝗿 𝗦𝗙𝗗𝗔 𝗽𝗿𝗶𝗰𝗶𝗻𝗴 𝗿𝘂𝗹𝗲𝘀, the first generic in 𝗦𝗮𝘂𝗱𝗶 𝗔𝗿𝗮𝗯𝗶𝗮 would likely be listed at ~$𝟮.𝟴𝟰/𝘁𝗮𝗯 (70% of innovator price).

𝗘𝘀𝘁𝗶𝗺𝗮𝘁𝗲𝗱 𝗖𝗢𝗚𝗦 (𝗶𝗻𝗰𝗹𝘂𝗱𝗶𝗻𝗴 𝗳𝗼𝗿𝗺𝘂𝗹𝗮𝘁𝗶𝗼𝗻, 𝗰𝗼𝗻𝘃𝗲𝗿𝘀𝗶𝗼𝗻 & 𝗮𝗻𝗮𝗹𝘆𝘁𝗶𝗰𝗮𝗹):
~$𝟬.𝟲𝟬/𝘁𝗮𝗯, of which $𝟬.𝟰𝟴 would be the contribution from API.

Therefore, to make the economics work:
The Semaglutide (non-sterile) 𝗔𝗣𝗜 𝘀𝗵𝗼𝘂𝗹𝗱 𝗰𝗼𝘀𝘁 < $𝟯𝟰/𝗴 (𝗶.𝗲., < $𝟯𝟰,𝟮𝟴𝟲/𝗸𝗴).

𝗞𝗲𝘆 𝗜𝗻𝘀𝗶𝗴𝗵𝘁 𝗳𝗼𝗿 𝗚𝗲𝗻𝗲𝗿𝗶𝗰 𝗦𝘁𝗿𝗮𝘁𝗲𝗴𝘆 𝗧𝗲𝗮𝗺𝘀 𝘁𝗮𝗿𝗴𝗲𝘁𝗶𝗻𝗴 𝗚𝗖𝗖:
A viable oral semaglutide business case 𝗱𝗲𝗺𝗮𝗻𝗱𝘀 𝗔𝗣𝗜 𝗽𝗿𝗶𝗰𝗲𝘀 𝘁𝗼 𝗳𝗮𝗹𝗹 𝗯𝗲𝗹𝗼𝘄 $𝟯𝟰/𝗴 — a steep drop from current levels.

Until then, 𝗰𝗼𝗹𝗹𝗮𝗯𝗼𝗿𝗮𝘁𝗶𝗼𝗻, 𝗖𝗗𝗢 𝗶𝗻𝗻𝗼𝘃𝗮𝘁𝗶𝗼𝗻, and 𝗲𝗮𝗿𝗹𝘆 𝗹𝗶𝗰𝗲𝗻𝘀𝗶𝗻𝗴 could bridge the technical and economic challenges.

In the real market, today is 2025/09/09, the recombinant api price is around $90/g. If DMF and WC required, the price is around $130/g.

A manufacturer quoted as below:
​India/Emerging Markets:​​ 95−105/gm min. Not recommended.
​US/EU:​​ Higher (patent premium).
​Canada:​​ Expected 120−140/gm.

Anyone need semaglutide, plz contact me.
Email address: haoran.tse@gmail.com
Tel: +86 18575536586

Amycretin, developed by Novo Nordisk, is a single-molecule long-acting GLP-1 and amylin receptor agonist. Its mechanism of action achieves weight loss by simultaneously activating both receptors: • GLP-1 receptor activation: delays gastric emptying, promotes insulin secretion, and lowers blood sugar; • Activation of amylin receptors: It directly acts on the central nervous system, inhibits appetite and reduces energy intake. In July 2025, the molecular structure of Amycretin, a GLP-1 series product under Novo Nordisk, was officially disclosed.

The amycretin structure comprises a GLP-1 receptor agonist moiety (dark blue) and an amylin receptor agonist moiety (light blue) connected by a linker region (yellow). The amycretin peptide is acylated with a C18 diacid-based sidechain (white) at position K37 (when employing GLP-1 7-37 numbering). Aib, α-aminoisobutyric acid; Ala, alanine; Arg, arginine; Asp, aspartic acid; C, carbon; Gln, glutamine; GLP-1, glucagon-like peptide-1; Glu, glutamic acid; Gly, glycine; H, hydrogen; His, histidine; Ile, isoleucine; K, lysine; Leu, leucine; Lys, lysine; N, nitrogen; O, oxygen; OH, hydroxyl group; Phe, phenylalanine; Pro, proline; Ser, serine; Thr, threonine; Trp, tryptophan; Tyr, tyrosine; Val, valine.

Anyone need to enquire about the peptide raw materials, plz contact:
haoran.tse@gmail.com
+8618575536586

The synthesis of GLP-1 impurities is difficult. Now in China domestic market, generally impurities are provided by professional CRO which focus on peptide impurities.
Anyone need to know more, plz download the impurities list below.

GLP-1 impurities.xlsx
You can also contact me
Email: haoran.tse@gmail.com
Tel: +86 18575536586

Cinaceptide is a synthetic 21-peptide used for the treatment of respiratory distress syndrome in preterm infants. Discovery Laboratories Inc is the original research company and was approved for marketing by the US FDA in March 2012.

The structure of Cinaceptide is as below:

Basic information
Chinese name: sinapritide
English name: Sinapultide
Company number: GT-F041
CAS Number: 138531-07-4
Sequence: H-Lys-Leu-Leu-Leu-Leu-Leu-Lys-Leu-Lys-Leu-Lys-OH
Formula: C126H238N26O22
Molecular weight: 2469.4

1. Preparation of Fmoc-Lys(Boc)-resin
1) Take 100g of 2-chloro-triphenyl chlororesin (0.5mmol/g resin, 50mmol), soak in 1000ml DMF for 30 minutes, make the resin fully swollen, add DIPEA 20ml, Fmoc-Lys(Boc)-OH 23.5g, 25°C for 65 minutes. Add 50ml of methanol and react at 25°C for 60 minutes.
2) Drain and dry, wash three times with DMF, methanol and DMF respectively, and drain dry.
2. Preparation of Fmoc-Leu-Lys(Boc)-resin
1) Add 1000ml of unhatting reagent, react at 21-23°C for 18 minutes, drain dry, wash with DMF, methanol and DMF three times each, and drain dry.
2) Take 53.0g Fmoc-Leu-OH, 57.0g HATU, and 20.5g HOAt, dissolve with 520ml of peptide reagent, add to the reaction vessel, and react at 0-5°C for 55 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
3. Preparation of Fmoc-Leu-Leu-Lys(Boc)-resin
1) Add 1000ml of unhatting reagent, react at 21-23°C for 18 minutes, drain dry, wash with DMF, methanol and DMF three times each, and drain dry.
2) Take 53.0g Fmoc-Leu-OH, 57.0g HATU, and 20.5g HOAt, dissolve with 520ml of peptide reagent, add to the reaction vessel, and react at 0-5°C for 55 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
4. Preparation of Fmoc-Leu-Leu-Leu-Lys(Boc)-resin
1) Add 1000ml of unhatting reagent, react at 21-23°C for 18 minutes, drain dry, wash with DMF, methanol and DMF three times each, and drain dry.
2) Take 53.0g Fmoc-Leu-OH, 57.0g HATU, and 20.5g HOAt, dissolve with 520ml of peptide reagent, add to the reaction vessel, and react at 0-5°C for 55 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
5. Preparation of Fmoc-Leu-Leu-Leu-Leu-Leu-Lys(Boc)-resin
1) Add 1000ml of unhatting reagent, react at 21-23°C for 18 minutes, drain dry, wash with DMF, methanol and DMF three times each, and drain dry.
2) Take 53.0g Fmoc-Leu-OH, 57.0g HATU, and 20.5g HOAt, dissolve with 520ml of peptide reagent, add to the reaction vessel, and react at 0-5°C for 55 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
6. Preparation of Fmoc-Lys(Boc)-Leu-Leu-Leu-Leu-Leu-Lys(Boc)-resin
1) Add 1000ml of unhatting reagent, react at 21-23°C for 18 minutes, drain dry, wash with DMF, methanol and DMF three times each, and drain dry.
2) Take 70.5g of Fmoc-Lys(Boc)-OH, 57.0g HATU, and 20.5g HOAt, dissolve them with 520ml of peptide reagent, add them to the reaction vessel, and react at 0-5°C for 55 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
7. Preparation of Fmoc-Leu-Lys(Boc)-Leu-Leu-Lys(Boc)-resin
1) Add 1000ml of uncapping reagent, react at 27-29°C for 15 minutes, drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
2) Take 74.2g of Fmoc-Leu-OH, 79.5g HATU, and 28.6g of HOAt, dissolve them with 760ml of leptide reagent, add them to the reaction vessel, and react at 19-21°C for 45 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
8. Preparation of Fmoc-Leu-Leu-Lys(Boc)-Leu-Lys(Boc)-resin
1) Add 1000ml of unhatting reagent, react at 21-23°C for 18 minutes, drain dry, wash with DMF, methanol and DMF three times each, and drain dry.
2) Take 53.0g Fmoc-Leu-OH, 57.0g HATU, and 20.5g HOAt, dissolve with 520ml of peptide reagent, add to the reaction vessel, and react at 0-5°C for 55 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
9. Preparation of Fmoc-Leu-Leu-Leu-Lys(Boc)-Leu-Leu-Lys(Boc)-resin
1) Add 1000ml of unhatting reagent, react at 21-23°C for 18 minutes, drain dry, wash with DMF, methanol and DMF three times each, and drain dry.
2) Take 53.0g Fmoc-Leu-OH, 57.0g HATU, and 20.5g HOAt, dissolve with 520ml of peptide reagent, add to the reaction vessel, and react at 0-5°C for 55 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
10. Preparation of Fmoc-Leu-Leu-Leu-Leu-Lys(Boc)-Leu-Leu-Leu-Leu-D-Tyr (tBu)-Resin
1) Add 1000ml of unhatting reagent, react at 21-23°C for 18 minutes, drain dry, wash with DMF, methanol and DMF three times each, and drain dry.
2) Take 53.0g Fmoc-Leu-OH, 57.0g HATU, and 20.5g HOAt, dissolve with 520ml of peptide reagent, add to the reaction vessel, and react at 0-5°C for 55 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
11. Preparation of Fmoc-Lys(Boc)-Leu-Leu-Leu-Leu-Leu-Lys(Boc)-Leu-Leu-Lys(Boc)-resin
1) Add 1000ml of unhatting reagent, react at 21-23°C for 18 minutes, drain dry, wash with DMF, methanol and DMF three times each, and drain dry.
2) Take 70.5g of Fmoc-Lys(Boc)-OH, 57.0g HATU, and 20.5g HOAt, dissolve them with 520ml of peptide reagent, add them to the reaction vessel, and react at 0-5°C for 55 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
12. Preparation of Fmoc-Lue-Lys(Boc)-Leu-Leu-Leu-Leu-Lys(Boc)-Leu-Lys(Boc)-resin
1) Add 1000ml of unhatting reagent, react at 21-23°C for 18 minutes, drain dry, wash with DMF, methanol and DMF three times each, and drain dry.
2) Take 53.0g Fmoc-Leu-OH, 57.0g HATU, and 20.5g HOAt, dissolve with 520ml of peptide reagent, add to the reaction vessel, and react at 0-5°C for 55 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
13. Preparation of Fmoc-Leu-Lue-Lys (Boc)-Leu-Leu-Leu-Leu-Lys(Boc)-Leu-Leu-Lys (Boc)-Resin
1) Add 1000ml of unhatting reagent, react at 21-23°C for 18 minutes, drain dry, wash with DMF, methanol and DMF three times each, and drain dry.
2) Take 53.0g Fmoc-Leu-OH, 57.0g HATU, and 20.5g HOAt, dissolve with 520ml of peptide reagent, add to the reaction vessel, and react at 0-5°C for 55 minutes.
3) Drain and wash three times with DMF, methanol and DMF respectively, and drain dry.
14. Preparation of Fmoc-Leu-Lue-Lue-Lys (Boc)-Leu-Leu-Leu-Leu

Anyone need enquiry about peptide synthesis, plz contact haoran.tse@gmail.com Tel: +8618575536586